PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g19290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family M-type_MADS
Protein Properties Length: 259aa    MW: 29909.1 Da    PI: 7.4848
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g19290genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.61.6e-131149341
                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                i+++ nr+ tf  R++ ++KK +EL +LC++++++ii++
  CA07g19290 11 IQDHKNRKSTFVMRKASLIKKISELAILCGIKACMIIYG 49
                899***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.414149IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-13160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-16179IPR002100Transcription factor, MADS-box
CDDcd002663.62E-18249No hitNo description
PfamPF003196.9E-131149IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRAKINMEL IQDHKNRKST FVMRKASLIK KISELAILCG IKACMIIYGG IDDQVVPQHD  60
QIWPNDPKEV EELINLYKNQ PLEGRSKRAK SLSNFFENQK KKKAEIKEEK YPTWYSRFDY  120
LSEKELRNLA RVLEKRIDDA KGKVEFLKSA NIGSSSLLSH QEIQDYTELM NNNYYNLMNQ  180
TTYPWPSINY KNFFQENIPS GVISMGAKME IQPLTIDDYQ FDDADYSMKI EAENWLANNG  240
IGTSSTIMVY PIIYNAST*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556871.10.0PREDICTED: agamous-like MADS-box protein AGL103 isoform X2
TrEMBLK4D6Y45e-90K4D6Y4_SOLLC; Uncharacterized protein
STRINGSolyc11g020320.1.12e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-18M-type_MADS family protein